Dusp12 (NM_023173) Mouse Recombinant Protein

CAT#: TP520464

Purified recombinant protein of Mouse dual specificity phosphatase 12 (Dusp12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220464 representing NM_023173
Red=Cloning site Green=Tags(s)

MLEAQGSNHGCERQAPTASPASSAGHAVEVRPGLYLGGAAAVAEPGHLREAGITAVLTVDSEPAFPAGAG
FEGLRSLFVPALDKPETDLLSHLDRCVAFIGQARSEGRAVLVHCHAGVSRSVAVVMAFIMKTDQLTFEKA
YDILRTVKPEAKVNEGFEWQLKLYEAMGYEVDTSSAFYKQYRLQKVTEKCPKLWNLPQELFAVDPTTISQ
GLKDDILYKCRKCRRSLFRHSSILGHSEGSGPIAFAHKRTAPSSVLTTGSQAQCTSYFIEPVQWMESTLL
GVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKMLPVLGSQTKKL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075662
Locus ID 80915
UniProt ID Q9D0T2
Refseq Size 1413
Cytogenetics 1 H3
Refseq ORF 1017
Synonyms 1190004O14Rik; AA027408; AW049275; ENSMUSG00000045460; ESTM36; LMW-DSP4; mVH1; T-DSP4; VH1
Summary Dual specificity phosphatase; can dephosphorylate both phosphotyrosine and phosphoserine or phosphothreonine residues. Can dephosphorylate glucokinase (in vitro). Has phosphatase activity with the synthetic substrate 6,8-difluoro-4-methylumbelliferyl phosphate and other in vitro substrates.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...