Arfgap1 (NM_145760) Mouse Recombinant Protein

CAT#: TP520358

Purified recombinant protein of Mouse ADP-ribosylation factor GTPase activating protein 1 (Arfgap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR220358 representing NM_145760
Red=Cloning site Green=Tags(s)

MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDI
ELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYSSRAAALFRDKVATLAEGKEWSLESSPAQNWTPPQPK
TLQFTAHRASGQPQSAAASGDKAFEDWLNDDLGSYQGAQENRYVGFGNTVPPQKREDDFLNNAMSSLYSG
WSSFTTGASKFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGRIFDDVSSGVSQLASKVQ
GVGSKGWRDVTTFFSGKAEDSSDRPLEGHSYQNSSGDNSQNSNIDQSFWETFGSAEPPKAKSPSSDSWTC
ADASTGRRSSDSWDVWGSGSASNNKNSNSDGWESWEGASGEGRAKATKKAAPSTADEGWDNQNW

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_665703
Locus ID 228998
UniProt ID Q9EPJ9
Refseq Size 2721
Cytogenetics 2 103.53 cM
Refseq ORF 1242
Synonyms AI115377; Arf1gap
Summary GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and TMED2. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...