Brk1 (NM_133937) Mouse Recombinant Protein

CAT#: TP519863

Purified recombinant protein of Mouse BRICK1, SCAR/WAVE actin-nucleating complex subunit (Brk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR219863 representing NM_133937
Red=Cloning site Green=Tags(s)

MAGQEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
GETLT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 9.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598698
Locus ID 101314
UniProt ID Q91VR8
Refseq Size 1110
Cytogenetics 6 E3
Refseq ORF 225
Synonyms 6720456B07Rik; AW011779
Summary Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex (By similarity). As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (PubMed:27605705).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...