Icam4 (NM_023892) Mouse Recombinant Protein
CAT#: TP519259
Purified recombinant protein of Mouse intercellular adhesion molecule 4, Landsteiner-Wiener blood group (Icam4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Icam4" proteins (1)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR219259 representing NM_023892
Red=Cloning site Green=Tags(s) MESALLLPSLLLVAAYPRGGSPQQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVH SSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHK YTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDG LVVRSSSAPVMLTVLALSPASIALASTSIATLVGILLAVGAVYVRKYLAVQT myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 28.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_076381 |
Locus ID | 78369 |
UniProt ID | Q9ERM2 |
Refseq Size | 907 |
Cytogenetics | 9 7.69 cM |
Refseq ORF | 786 |
Synonyms | 1810015M19Rik; Cd242; ICAM-4 |
Summary | Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP750228 | Purified recombinant protein of intercellular adhesion molecule 4 isoform 1 precursor(Icam4), 23Gln-231Ser |
CNY 2,480.00 |