Dusp13 (NM_013849) Mouse Recombinant Protein

CAT#: TP518320

Purified recombinant protein of Mouse dual specificity phosphatase 13 (Dusp13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218320 representing NM_013849
Red=Cloning site Green=Tags(s)

MQAGQRPLQSALGIYLPKSLSQTPRCPSVRTLAPLGLCSLREEGRQRGNSRGDQEKCVLRLQLKRMDSLQ
KQELRRPKIHGAVQVSPYQPPTLASLQRLLWVRRTATLTHINEVWPNLFLGDAYAARDKGRLIQLGITHV
VNVAAGKFQVDTGAKFYRGTPLEYYGIEADDNPFFDLSVHFLPVARYIRDALNIPRSRVLVHCAMGVSRS
ATIVLAFLMIFENMTLVDAIQTVQAHRDICPNSGFLRQLQVLDNRLRRETGRL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 29.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_038877
Locus ID 27389
UniProt ID Q9QYJ7, Q7TNW3, Q9DA25
Refseq Size 1071
Cytogenetics 14 A3
Refseq ORF 789
Synonyms DUSP13A; DUSP13B; Gm1203; LMW-D; LMW-DSP6; MDSP; TMD; TMDP; TS-D; TS-DSP6
Summary Members of the protein-tyrosine phosphatase superfamily cooperate with protein kinases to regulate cell proliferation and differentiation. This superfamily is separated into two families based on the substrate that is dephosphorylated. One family, the dual specificity phosphatases (DSPs) acts on both phosphotyrosine and phosphoserine/threonine residues. This gene encodes different but related DSP proteins through the use of non-overlapping open reading frames, alternate splicing, and presumed different transcription promoters. Expression of the distinct proteins from this gene has been found to be tissue specific and the proteins may be involved in postnatal development of specific tissues. A protein encoded by the upstream ORF was found in skeletal muscle, whereas the encoded protein from the downstream ORF was found only in testis. In humans, a similar pattern of expression was found. Multiple alternatively spliced transcript variants were described, but the full-length sequence of only some were determined. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...