Vps41 (NM_172120) Mouse Recombinant Protein

CAT#: TP518234

Purified recombinant protein of Mouse VPS41 HOPS complex subunit (Vps41), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR218234 representing NM_172120
Red=Cloning site Green=Tags(s)

MAEAEEQETESLEESTDESEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLALGTHYGKVYLLD
VQGNITQKFDVSPVKINQISLDDSGEHMGVCSEDGKLQVFGLYSGEEFHETFDCPIKIIAVHPQFVRSSC
KQFVTGGKKLLLFERTWMNRWKSSVLHEGEGNIRSVKWRGHLIAWANNMGVKVFDITSKQRISNVPRDDI
SLRPDMYPCSLCWKDNVTLIIGWGTSIKICSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQL
VVLSYVKEVSEKTEREYCARPRLDIIQPLPETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYVVSP
RDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQRNIKRHKILDIGLAYVNHLVERGEYDMAARKCQKI
LGKNASLWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLIREWPGDLYNNS
VIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVFQLIHKHNLFSSIKDKIVLLMD
FDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHKLFKRDHHKGQRYHEKQISLYAEYDRPNLLPF
LRDSTHCPLEKALEICQQRNFVEETVYLLSRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLIL
YSIDKPPFITGLLNNIGTHVDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSL
LKKMHRTQMKGVLVDEENICESCLSPILPTDAAKPFSVVVFHCRHMFHKECLPMPSMNAPAQYCNICSAK
NRGPGSAILEMKK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 99.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_742118
Locus ID 218035
UniProt ID Q5KU39
Refseq Size 3212
Cytogenetics 13 6.75 cM
Refseq ORF 2559
Synonyms AI317346; mVam2; Vam2
Summary Plays a role in vesicle-mediated protein trafficking to lysosomal compartments including the endocytic membrane transport and autophagic pathways. Believed to act in part as a core component of the putative HOPS endosomal tethering complex is proposed to be involved in the Rab5-to-Rab7 endosome conversion probably implicating MON1A/B, and via binding SNAREs and SNARE complexes to mediate tethering and docking events during SNARE-mediated membrane fusion. The HOPS complex is proposed to be recruited to Rab7 on the late endosomal membrane and to regulate late endocytic, phagocytic and autophagic traffic towards lysosomes. Involved in homotypic vesicle fusions between late endosomes and in heterotypic fusions between late endosomes and lysosomes implicated in degradation of endocytosed cargo. Required for fusion of autophagosomes with lysosomes. May link the HOPS complex to endosomal Rab7 via its association with RILP and to lysosomal membranes via its association with ARL8B, suggesting that these interactions may bring the compartments to close proximity for fusion. Involved in the direct trans-Golgi network to late endosomes transport of lysosomal membrane proteins independently of HOPS. Involved in sorting to the regulated secretory pathway presumably implicating the AP-3 adaptor complex. May play a role in HOPS-independent function in the regulated secretory pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...