Pphln1 (NM_175363) Mouse Recombinant Protein

CAT#: TP517466

Purified recombinant protein of Mouse periphilin 1 (Pphln1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR217466 representing NM_175363
Red=Cloning site Green=Tags(s)

MWSEGRYDYDRLPRERVPPRSHPSDESGYRWLRDDHSTSRQPDYRDMRDGFRRKSFYSSHYSRDRSPHKR
DAPFFRESPVGRKDSPHSRSGSSVSSRSYSPERSRTHSFHQSQHRKSSRVGASYKRQNEAIRGRGKERSI
QSVKTSRDASPSSSSAVASSKALDKPSRLTEKELAEAESKWANETLEKSDESNLAEMNEFEAGSTAPLFI
DQTEEPESNTVDGTELYEDSQLSNRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSVQFALR
QNLHEIGERCVEELKRFITEYDNSAQDFGDPF

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 36.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_780572
Locus ID 223828
UniProt ID Q8K2H1
Refseq Size 3828
Cytogenetics 15 E3
Refseq ORF 936
Synonyms CR; HSPC206; HSPC232
Summary Component of the HUSH complex, a multiprotein complex that mediates epigenetic repression. The HUSH complex is recruited to genomic loci rich in H3K9me3 and is probably required to maintain transcriptional silencing by promoting recruitment of SETDB1, a histone methyltransferase that mediates further deposition of H3K9me3. In the HUSH complex, contributes to the maintenance of the complex at chromatin. Acts as a transcriptional corepressor and regulates the cell cycle, probably via the HUSH complex. The HUSH complex is also involved in the silencing of unintegrated retroviral DNA: some part of the retroviral DNA formed immediately after infection remains unintegrated in the host genome and is transcriptionally repressed. May be involved in epithelial differentiation by contributing to epidermal integrity and barrier formation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...