Gp9 (NM_018762) Mouse Recombinant Protein
CAT#: TP516187
Purified recombinant protein of Mouse glycoprotein 9 (platelet) (Gp9), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR216187 protein sequence
Red=Cloning site Green=Tags(s) MTTWGLLFLLWPATTDTQACPRPCTCQSLETMGLKVNCEGQGLTALPVIPAHTRQLLLANNSLRSVPPGA FDHLPQLWDLDVTHNPWHCDCSLTYLRLWLEDHMPEALMHVYCASPDLATRRPLGQLTGYELGSCGWKLP PSWAYPGVWWDVSLVAVAVLGLILLAGLLNTFTESRN myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 19.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061232 |
Locus ID | 54368 |
UniProt ID | O88186 |
Refseq Size | 811 |
Cytogenetics | 6 39.13 cM |
Refseq ORF | 534 |
Synonyms | Cd42; GPIX |
Summary | The GPIb-V-IX complex functions as the vWF receptor and mediates vWF-dependent platelet adhesion to blood vessels. The adhesion of platelets to injured vascular surfaces in the arterial circulation is a critical initiating event in hemostasis. GP-IX may provide for membrane insertion and orientation of GP-Ib (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |