Ctsh (NM_007801) Mouse Recombinant Protein

CAT#: TP515191

Purified recombinant protein of Mouse cathepsin H (Ctsh), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR215191 representing NM_007801
Red=Cloning site Green=Tags(s)

MWAALPLLCAGAWLLSTGATAELTVNAIEKFHFKSWMKQHQKTYSSVEYNHRLQMFANNWRKIQAHNQRN
HTFKMALNQFSDMSFAEIKHKFLWSEPQNCSATKSNYLRGTGPYPSSMDWRKKGNVVSPVKNQGACGSCW
TFSTTGALESAVAIASGKMLSLAEQQLVDCAQAFNNHGCKGGLPSQAFEYILYNKGIMEEDSYPYIGKDS
SCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLMYKSGVYSSKSCHKTPDKVNHA
VLAVGYGEQNGLLYWIVKNSWGSQWGENGYFLIERGKNMCGLAACASYPIPQV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_031827
Locus ID 13036
UniProt ID P49935
Refseq Size 1627
Cytogenetics 9 47.4 cM
Refseq ORF 999
Synonyms AL022844
Summary This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cathepsin H mini, heavy, and light chains. In rat and human, these three chains can associate to form the mature enzyme, which has both aminopeptidase and endopeptidase activities. Homozygous knockout mice for this gene exhibit impaired lung surfactant processing and reduced tumorigenesis in a pancreatic cancer model. Multiple pseudogenes of this gene have been identified in the genome. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...