Ghrl (NM_021488) Mouse Recombinant Protein

CAT#: TP512134

Purified recombinant protein of Mouse ghrelin (Ghrl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (4)
Rabbit polyclonal anti Ghrelin (ms, rt); neat antiserum
    • 50 ul

CNY 5,467.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00


Rabbit polyclonal anti Ghrelin (ms, rt); purified rabbit IgG
    • 400 ug

CNY 10,313.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR212134 representing NM_021488
Red=Cloning site Green=Tags(s)

MLSSGTICSLLLLSMLWMDMAMAGSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEE
ELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 13.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067463
Locus ID 58991
UniProt ID Q9EQX0, A2RSS9
Refseq Size 527
Cytogenetics 6 52.84 cM
Refseq ORF 351
Synonyms 2210006E23Rik; Gh; Ghr; m46; MT; MTLRP; MTLRPAP
Summary This gene encodes a preproprotein that undergoes proteolytic processing to yield two bioactive peptides, ghrelin and obestatin. The hormone ghrelin plays a role in enhancing appetite and has numerous other biological functions that include stimulating the secretion of growth hormone (somatotropin) from the anterior pituitary gland. Obestatin is thought to be a hormone that functions in decreasing appetite. Mice lacking the encoded protein develop normally and exhibit no gross anatomical abnormalities. This gene encodes distinct isoforms, some or all of which may undergo similar proteolytic processing. [provided by RefSeq, Jul 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...