Ghrl (NM_021488) Mouse Recombinant Protein
CAT#: TP512134
Purified recombinant protein of Mouse ghrelin (Ghrl), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR212134 representing NM_021488
Red=Cloning site Green=Tags(s) MLSSGTICSLLLLSMLWMDMAMAGSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPEDRGQAEETEE ELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPADK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 13.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067463 |
Locus ID | 58991 |
UniProt ID | Q9EQX0 |
Refseq Size | 527 |
Cytogenetics | 6 52.84 cM |
Refseq ORF | 351 |
Synonyms | 2210006E23Rik; Gh; Ghr; m46; MT; MTLRP; MTLRPAP |
Summary | This gene encodes a preproprotein that undergoes proteolytic processing to yield two bioactive peptides, ghrelin and obestatin. The hormone ghrelin plays a role in enhancing appetite and has numerous other biological functions that include stimulating the secretion of growth hormone (somatotropin) from the anterior pituitary gland. Obestatin is thought to be a hormone that functions in decreasing appetite. Mice lacking the encoded protein develop normally and exhibit no gross anatomical abnormalities. This gene encodes distinct isoforms, some or all of which may undergo similar proteolytic processing. [provided by RefSeq, Jul 2016] |
Documents
FAQs |
SDS |