Ccar2 (NM_146055) Mouse Recombinant Protein

CAT#: TP511192

Purified recombinant protein of Mouse cell cycle activator and apoptosis regulator 2 (Ccar2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR211192 protein sequence
Red=Cloning site Green=Tags(s)

MSQFKRQRINPLPGGRNFSGAASTSLLGPPPGLLTPPVATDLSQNARHLQSGEKQRVFTGIVTSLHDYFG
VVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQPLLKSPAPPLLHVAALGQKQG
ILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNRFPARGPHGRLDQGRSDDYDSKKRKQRAGGE
PWGAKKPRHDLSPYRVHLTPYTVDSPTCDFLELQRRYRSLLVPSDFLSVHLSWLSAFPLGQPFSLHHPSR
IQVSSEKEAAPDTGAEPSPEDSDPTYSSKVLLLSSPGLEEFYRCCMLFVDDMAEPRETPEHPLKQLKFLL
GRKEEEAVLVGGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSTCTKWWRFAEFQYLQPGPPRQLH
TVVVYLPDVWTIMPTLEEWEALCQQKATEAAPQPHEASGEAEATEQAPDVSEQADTSKQNTETMEATTQQ
DVDTDLPEAPPPPLEPAVMARPRCVNLSLYGIVEDRRPKERISFEVVVLAELFVEMLQRDFGYRIYKTLL
SLPEKVVSPPEPEKEEAAKEDAVKEEEAVKEEAVKVSKDEVQNEGTAAESDSPLKEDGLLPKRPSSGGEE
EEKARGEAAEDLCEMALDPDLLLLRDDGEDEFAGAKLEETEVRSVASNQSEMEYSSLQDMPKELDPSTVL
PLDCLLAFVFFDANWCGYLHRRDLERVLLTLGIRLSAEQAKQLVSRVVAQNICQYRSLQYSRAEVLDDGL
PEDVLFGNLDLLPPSGKSTKPGAAPTEHKGLVPHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKLE
ESHNRFSATEVTNKTLAAEMQELRARLAEAEETARTAERQKNQLQRQMQDFRRRLTPLHLEMQRIVEKAD
SWVEKEEPTPSN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 103 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_666167
Locus ID 219158
UniProt ID Q8VDP4
Refseq Size 3705
Cytogenetics 14 D2
Refseq ORF 2769
Synonyms 2610301G19Rik; Dbc1; mKIAA1967
Summary Core component of the DBIRD complex, a multiprotein complex that acts at the interface between core mRNP particles and RNA polymerase II (RNAPII) and integrates transcript elongation with the regulation of alternative splicing: the DBIRD complex affects local transcript elongation rates and alternative splicing of a large set of exons embedded in (A + T)-rich DNA regions. Inhibits SIRT1 deacetylase activity leading to increasing levels of p53/TP53 acetylation and p53-mediated apoptosis (By similarity). As part of a histone H3-specific methyltransferase complex may mediate ligand-dependent transcriptional activation by nuclear hormone receptors (By similarity). Inhibits SUV39H1 methyltransferase activity. Plays a critical role in maintaining genomic stability and cellular integrity following UV-induced genotoxic stress (By similarity) Regulates the circadian expression of the core clock components NR1D1 and ARNTL/BMAL1. Enhances the transcriptional repressor activity of NR1D1 through stabilization of NR1D1 protein levels by preventing its ubiquitination and subsequent degradation. Acts as a regulator of PCK1 expression and gluconeogenesis by a mechanism that involves, at least in part, both NR1D1 and SIRT1 (PubMed:24415752). Negatively regulates the deacetylase activity of HDAC3 and can alter its subcellular localization (PubMed:21030595). Plays an important role in tumor suppression through p53/TP53 regulation; stabilizes p53/TP53 by affecting its interaction with ubiquitin ligase MDM2 (PubMed:25732823). Represses the ligand-dependent transcriptional activation function of ESR2. Positively regulates the beta-catenin pathway (canonical Wnt signaling pathway) and is required for MCC-mediated repression of the beta-catenin pathway. Represses ligand-dependent transcriptional activation function of NR1H2 and NR1H3 and inhibits the interaction of SIRT1 with NR1H3. Represses the transcriptional activator activity of BRCA1. Inhibits SIRT1 in a CHEK2 and PSEM3-dependent manner and inhibits the activity of CHEK2 in vitro (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...