Appl2 (NM_145220) Mouse Recombinant Protein
CAT#: TP509855
Purified recombinant protein of Mouse adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2 (Appl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR209855 protein sequence
Red=Cloning site Green=Tags(s) MPAVDKLLLEEALQDSPQARSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSRQLLAYEK QNFALGKGDEEVISTLHYFSKVMDELNGLHTELAKQLADTMVLPVIQFREKDLTEVSTLKDLFGLASSEH DLSMAKYSRLPKKKENEKAKTEIVKEVAAARRKQHLSSLQYYCALNALQYRKRAAMMEPLIGFAHGQINF FKRGAEMFSKSMDGFLSSVKDMVQSIQVELEAEADKMRVSQQELLSVSESVYTPDIDVATAQINRNLIQK TGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGK PGIILQAESRKEYEEWICAVNNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCSSQNIKNS DIEDDNIVPKATASIPETEELIAPGTPIQFDIVLPATEFLDQNRGGRRTNPFGETEDGSFPEAEDSLLQQ MFIVRFLGSMAVKTDSTAEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQTLRLIDPQTQVSRACFELTS VTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAINLGKEIIEVQKDPEALARLMLSV PLTNDGKYVLLNDQADDTGGSPSENRGAESEA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 73.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_660255 |
Locus ID | 216190 |
UniProt ID | Q8K3G9, Q3TVI6 |
Refseq Size | 2958 |
Cytogenetics | 10 C1 |
Refseq ORF | 1989 |
Synonyms | Dip3b |
Summary | Multifunctional adapter protein that binds to various membrane receptors, nuclear factors and signaling proteins to regulate many processes, such as cell proliferation, immune response, endosomal trafficking and cell metabolism (PubMed:25568335, PubMed:27219021, PubMed:25328665, PubMed:19661063, PubMed:29467283). Regulates signaling pathway leading to cell proliferation through interaction with RAB5A and subunits of the NuRD/MeCP1 complex (By similarity). Plays a role in immune response by modulating phagocytosis, inflammatory and innate immune responses (PubMed:25568335, PubMed:27219021, PubMed:25328665). In macrophages, enhances Fc-gamma receptor-mediated phagocytosis through interaction with RAB31 leading to activation of PI3K/Akt signaling (PubMed:25568335). In response to LPS, modulates inflammatory responses by playing a key role on the regulation of TLR4 signaling and in the nuclear translocation of RELA/NF-kappa-B p65 and the secretion of pro- and anti-inflammatory cytokines (PubMed:27219021). Also functions as a negative regulator of innate immune response via inhibition of AKT1 signaling pathway by forming a complex with APPL1 and PIK3R1 (PubMed:25328665). Plays a role in endosomal trafficking of TGFBR1 from the endosomes to the nucleus (By similarity). plays a role in cell metabolism by regulating adiponecting ans insulin signaling pathways and adaptative thermogenesis (PubMed:19661063, PubMed:29467283) (By similarity). In muscle, negatively regulates adiponectin-simulated glucose uptake and fatty acid oxidation by inhibiting adiponectin signaling pathway through APPL1 sequestration thereby antagonizing APPL1 action (PubMed:19661063). In muscles, negativeliy regulates insulin-induced plasma membrane recruitment of GLUT4 and glucose uptake through interaction with TBC1D1 (By similarity). Plays a role in cold and diet-induced adaptive thermogenesis by activating ventromedial hypothalamus (VMH) neurons throught AMPK inhibition which enhances sympathetic outflow to subcutaneous white adipose tissue (sWAT), sWAT beiging and cold tolerance (PubMed:29467283). Also plays a role in other signaling pathways namely Wnt/beta-catenin, HGF and glucocorticoid receptor signaling (PubMed:28965332, PubMed:29675572, PubMed:26445298). Positive regulator of beta-catenin/TCF-dependent transcription through direct interaction with RUVBL2/reptin resulting in the relief of RUVBL2-mediated repression of beta-catenin/TCF target genes by modulating the interactions within the beta-catenin-reptin-HDAC complex (By similarity). May affect adult neurogenesis in hippocampus and olfactory system via regulating the sensitivity of glucocorticoid receptor (PubMed:28965332, PubMed:29675572). Required for fibroblast migration through HGF cell signaling (PubMed:26445298).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |