Appl2 (NM_145220) Mouse Recombinant Protein

CAT#: TP509855

Purified recombinant protein of Mouse adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2 (Appl2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209855 protein sequence
Red=Cloning site Green=Tags(s)

MPAVDKLLLEEALQDSPQARSLLSVFEEDAGTLTDYTNQLLQAMQRVYGAQNEMCLATQQLSRQLLAYEK
QNFALGKGDEEVISTLHYFSKVMDELNGLHTELAKQLADTMVLPVIQFREKDLTEVSTLKDLFGLASSEH
DLSMAKYSRLPKKKENEKAKTEIVKEVAAARRKQHLSSLQYYCALNALQYRKRAAMMEPLIGFAHGQINF
FKRGAEMFSKSMDGFLSSVKDMVQSIQVELEAEADKMRVSQQELLSVSESVYTPDIDVATAQINRNLIQK
TGYLNLRNKTGLVTTTWERLYFFTQGGNLMCQPRGAVAGGLIQDLDNCSVMAVDCEDRRYCFQISTPSGK
PGIILQAESRKEYEEWICAVNNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSCSSQNIKNS
DIEDDNIVPKATASIPETEELIAPGTPIQFDIVLPATEFLDQNRGGRRTNPFGETEDGSFPEAEDSLLQQ
MFIVRFLGSMAVKTDSTAEVIYEAMRQVLAARAIHNIFRMTESHLMVTSQTLRLIDPQTQVSRACFELTS
VTQFAAHQENKRLVGFVIRVPESTGEESLSTYIFESNSEGEKICYAINLGKEIIEVQKDPEALARLMLSV
PLTNDGKYVLLNDQADDTGGSPSENRGAESEA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 73.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_660255
Locus ID 216190
UniProt ID Q8K3G9, Q3TVI6
Refseq Size 2958
Cytogenetics 10 C1
Refseq ORF 1989
Synonyms Dip3b
Summary Multifunctional adapter protein that binds to various membrane receptors, nuclear factors and signaling proteins to regulate many processes, such as cell proliferation, immune response, endosomal trafficking and cell metabolism (PubMed:25568335, PubMed:27219021, PubMed:25328665, PubMed:19661063, PubMed:29467283). Regulates signaling pathway leading to cell proliferation through interaction with RAB5A and subunits of the NuRD/MeCP1 complex (By similarity). Plays a role in immune response by modulating phagocytosis, inflammatory and innate immune responses (PubMed:25568335, PubMed:27219021, PubMed:25328665). In macrophages, enhances Fc-gamma receptor-mediated phagocytosis through interaction with RAB31 leading to activation of PI3K/Akt signaling (PubMed:25568335). In response to LPS, modulates inflammatory responses by playing a key role on the regulation of TLR4 signaling and in the nuclear translocation of RELA/NF-kappa-B p65 and the secretion of pro- and anti-inflammatory cytokines (PubMed:27219021). Also functions as a negative regulator of innate immune response via inhibition of AKT1 signaling pathway by forming a complex with APPL1 and PIK3R1 (PubMed:25328665). Plays a role in endosomal trafficking of TGFBR1 from the endosomes to the nucleus (By similarity). plays a role in cell metabolism by regulating adiponecting ans insulin signaling pathways and adaptative thermogenesis (PubMed:19661063, PubMed:29467283) (By similarity). In muscle, negatively regulates adiponectin-simulated glucose uptake and fatty acid oxidation by inhibiting adiponectin signaling pathway through APPL1 sequestration thereby antagonizing APPL1 action (PubMed:19661063). In muscles, negativeliy regulates insulin-induced plasma membrane recruitment of GLUT4 and glucose uptake through interaction with TBC1D1 (By similarity). Plays a role in cold and diet-induced adaptive thermogenesis by activating ventromedial hypothalamus (VMH) neurons throught AMPK inhibition which enhances sympathetic outflow to subcutaneous white adipose tissue (sWAT), sWAT beiging and cold tolerance (PubMed:29467283). Also plays a role in other signaling pathways namely Wnt/beta-catenin, HGF and glucocorticoid receptor signaling (PubMed:28965332, PubMed:29675572, PubMed:26445298). Positive regulator of beta-catenin/TCF-dependent transcription through direct interaction with RUVBL2/reptin resulting in the relief of RUVBL2-mediated repression of beta-catenin/TCF target genes by modulating the interactions within the beta-catenin-reptin-HDAC complex (By similarity). May affect adult neurogenesis in hippocampus and olfactory system via regulating the sensitivity of glucocorticoid receptor (PubMed:28965332, PubMed:29675572). Required for fibroblast migration through HGF cell signaling (PubMed:26445298).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...