Pak4 (NM_027470) Mouse Recombinant Protein

CAT#: TP509234

Purified recombinant protein of Mouse p21 (RAC1) activated kinase 4 (Pak4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR209234 protein sequence
Red=Cloning site Green=Tags(s)

MFGKKKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTI
VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRESPPPPARAHQENGMLEERAAPARMAPDKAGSRARATG
HSEAGSGSGDRRRVGPEKRPKSSRDGPGGPQEASRDKRPLSGPDVSTPQPGSLTSGTKLAAGRPFNTYPR
ADTDHPPRGAQGEPHTMAPNGPSATGLAAPQSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPARALAAP
AVPPAPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVA
VKKMDLRKQQRRELLFNEVVIMRDYRHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIA
AVCLAVLQALAVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELIS
RLPYGPEVDIWSLGVMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKASPSLKGFLDRLLVRDPA
QRATAAELLKHPFLTKAGPPASIVPLMRQHRTR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 64.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081746
Locus ID 70584
UniProt ID Q8BTW9
Refseq Size 2898
Cytogenetics 7 B1
Refseq ORF 1782
Synonyms 5730488L07Rik; AW555722; mKIAA1142
Summary Serine/threonine protein kinase that plays a role in a variety of different signaling pathways including cytoskeleton regulation, cell migration, growth, proliferation or cell survival. Activation by various effectors including growth factor receptors or active CDC42 and RAC1 results in a conformational change and a subsequent autophosphorylation on several serine and/or threonine residues. Phosphorylates and inactivates the protein phosphatase SSH1, leading to increased inhibitory phosphorylation of the actin binding/depolymerizing factor cofilin. Decreased cofilin activity may lead to stabilization of actin filaments. Phosphorylates LIMK1, a kinase that also inhibits the activity of cofilin. Phosphorylates integrin beta5/ITGB5 and thus regulates cell motility. Phosphorylates ARHGEF2 and activates the downstream target RHOA that plays a role in the regulation of assembly of focal adhesions and actin stress fibers. Stimulates cell survival by phosphorylating the BCL2 antagonist of cell death BAD. Alternatively, inhibits apoptosis by preventing caspase-8 binding to death domain receptors in a kinase independent manner. Plays a role in cell-cycle progression by controlling levels of the cell-cycle regulatory protein CDKN1A and by phosphorylating RAN.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...