Dpysl3 (NM_009468) Mouse Recombinant Protein

CAT#: TP508981

Purified recombinant protein of Mouse dihydropyrimidinase-like 3 (Dpysl3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208981 representing NM_009468
Red=Cloning site Green=Tags(s)

MLNGSVVTTFFLSGLPHPPVLDSMLFGIFLVIYILTVLGNLLILMVIRVDSHLHTPMYYFLTNLSFIDMW
FSTVTVPKMLMTLVSTGGGAISFHSCVAQLYCFHFLGSTECFLYTVMSYDRYLAISYPLRYSSMMSGRVC
ALLAAGTWITGSLHSAVQTTLIFHLPYCGPNEIQHYFCDGPPILKLACADTSAIEMVIFVNIGVVASGCF
FLISLSYVSIVCSILRIRTSEGRHRAFQTCASHCIVVLCFFVPCVFIYLRPGSRDAVDGVVTVFYTVLTP
LLNPVVYTLRNKEVKKALFKLKDKVAFSQR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 62.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033494
Locus ID 22240
UniProt ID Q62188
Refseq Size 2076
Cytogenetics 18 B3
Refseq ORF 930
Synonyms CRMP; CRMP-4; DRP-3; TUC4; U; Ul; Ulip; ULIP-1; Ulip1
Summary This gene encodes a protein that belongs to the TUC (TOAD-64/Ulip/CRMP) family of proteins. Members of this family are phosphoproteins that function in axonal guidance and neuronal differentiation during development and regeneration of the nervous system. A mutation in the human gene is associated with amyotrophic lateral sclerosis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...