Eif2d (NM_001136070) Mouse Recombinant Protein

CAT#: TP508977

Purified recombinant protein of Mouse eukaryotic translation initiation factor 2D (Eif2d), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208977 representing NM_001136070
Red=Cloning site Green=Tags(s)

MGNVPLLREVGKCQRNMFGRSTASSKGSSNSRSSSSTSPKKGPRREADALMFIQIFIHLLKSNIGTGFLG
LPLAVKNAGLLVGPVSLLAIGALTVHCMDILLNCACHLTQRLQRSFVNYEETTMYSLETCPSPWLRTHSV
WGRYVVSFLLIVTQLGFCSVYFMFLADNLQQIMEEAHFTSNVCQPRQSLVMTSILDTRFYMLTILPFLIL
LVLIQNPQVLSIFSTLATITTLSSLALIFEYLIQTPHHSNLPLVANWKTFLLFFGTAIFTFEGVGMVLPL
KSQMKSPQQFPAVLYLGMSFVIFLYICLGTLGYMKFGTDTQASITLNLPICWLYQSVKLMYSVGIFFTYA
LQFHVPAEIIVPYVVSRVSENWALFVDLTVRTALVCLTCFSAVLIPRLDLVISLVGSVSSSALAIIIPPL
LEIATFYSENISCATIVKDIMISILGLLGCVLGTYQALYEMTQQTHFYMANSTRVHI

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001129542
Locus ID 16865
UniProt ID Q61211
Refseq Size 1976
Cytogenetics 1 56.9 cM
Refseq ORF 1431
Synonyms D1Ertd5e; Lgtn
Summary Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P-site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...