Ubqln1 (NM_152234) Mouse Recombinant Protein

CAT#: TP508794

Purified recombinant protein of Mouse ubiquilin 1 (Ubqln1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208794 protein sequence
Red=Cloning site Green=Tags(s)

MAESAESGGPPGAQDSAADGGPAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHIDQLVLI
FAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDNSAQQTNAPGSTVTSSPAPDSNPTSGSAANSSFGV
GGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLI
QRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQE
QFGGNPFASLVSSSSSAEGTQPSRTENRDPLPNPWAPQTSQSSPASGTTGSTTNTMSTSGGTATSTPAGQ
STSGPSLVPGAGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMLQSLSQNPDLAAQMQNPDTLSAM
SNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLAAGNSGGSSGTNAPSTAPSEDTNPQGGTAEPGHQQF
IQQMLQALAGVNPQLQSPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 58.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_689420
Locus ID 56085
UniProt ID Q8R317, Q3TN93
Refseq Size 3609
Cytogenetics 13 30.95 cM
Refseq ORF 1665
Synonyms 1110046H03Rik; 1810030E05Rik; AU019746; C77538; D13Ertd372e; Da41; Dsk2; Plic-1; Plic1; Xdrp1
Summary Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome. Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome. Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress. Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion. Negatively regulates the TICAM1/TRIF-dependent toll-like receptor signaling pathway by decreasing the abundance of TICAM1 via the autophagic pathway. Plays a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis. Promotes the ubiquitination and lysosomal degradation of ORAI1, consequently downregulating the ORAI1-mediated Ca2+ mobilization. Suppresses the maturation and proteasomal degradation of amyloid beta A4 protein (A4) by stimulating the lysine 63 (K63)-linked polyubiquitination. Delays the maturation of A4 by sequestering it in the Golgi apparatus and preventing its transport to the cell surface for subsequent processing (By similarity). Links CD47 to the cytoskeleton (PubMed:10549293).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...