Wrap53 (NM_144824) Mouse Recombinant Protein

CAT#: TP508531

Purified recombinant protein of Mouse WD repeat containing, antisense to Trp53 (Wrap53), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208531 protein sequence
Red=Cloning site Green=Tags(s)

MKTSEERLLAPDSLPPDLAPAPVPQGSPAEKNTDFEPVPPPCGGDDQPQLATDPVASLVVSQELQQGDSV
PLEVEFNTSSELSPGIEEQDVSEHASLPGEETNLPELESGEATEGVSEERAEVDEGDTFWTYSFSQVPRY
LSGSWSEFSTRSENFLKGCKWAPDGSCILTNSADNVLRIYNLPPELYSEQEQVDYAEMVPVLRMVEGDTI
YDYCWYSLMSSTQPDTSYVASSSRENPIHIWDAFTGELRASFRAYNHLDELTAAHSLCFSPDGSQLFCGF
NRTVRVFSTSRPGRDCEVRATFAKKQGQSGIISCIAFSPSQPLYACGSYGRTIGLYAWDDGSPLALLGGH
QGGITHLCFHPDGNLFFSGARKDAELLCWDLRQPGHLLWSLSREVTTNQRIYFDLDPSGQFLVSGNTSGV
VSVWDISGALSDDSKLEPVVTFLPQKDCTNGVSLHPTLPLLATASGQRVFPEPTNSGDEGELELELPLLS
LCHAHPECQLQLWWCGGGPDPSSPVDDQDEKGQRRTEAVGMS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 58.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_659073
Locus ID 216853
UniProt ID Q8VC51
Refseq Size 1896
Cytogenetics 11 B3
Refseq ORF 1599
Synonyms BC021790; Wdr79
Summary RNA chaperone that plays a key role in telomere maintenance and RNA localization to Cajal bodies (PubMed:29804836). Specifically recognizes and binds the Cajal body box (CAB box) present in both small Cajal body RNAs (scaRNAs) and telomerase RNA template component (TERC) (PubMed:29804836). Essential component of the telomerase holoenzyme complex, a ribonucleoprotein complex essential for the replication of chromosome termini that elongates telomeres in most eukaryotes (By similarity). In the telomerase holoenzyme complex, required to stimulate the catalytic activity of the complex (PubMed:29804836). Acts by specifically binding the CAB box of the TERC RNA and controlling the folding of the CR4/CR5 region of the TERC RNA, a critical step for telomerase activity (By similarity). In addition, also controls telomerase holoenzyme complex localization to Cajal body (By similarity). During S phase, required for delivery of TERC to telomeres during S phase and for telomerase activity (By similarity). In addition to its role in telomere maintenance, also required for Cajal body formation, probably by mediating localization of scaRNAs to Cajal bodies (By similarity). Also plays a role in DNA repair: phosphorylated by ATM in response to DNA damage and relocalizes to sites of DNA double-strand breaks to promote the repair of DNA double-strand breaks (By similarity). Acts by recruiting the ubiquitin ligase RNF8 to DNA breaks and promote both homologous recombination (HR) and non-homologous end joining (NHEJ) (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...