Sgo1 (NM_028232) Mouse Recombinant Protein

CAT#: TP508287

Purified recombinant protein of Mouse shugoshin 1 (Sgo1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR208287 representing NM_028232
Red=Cloning site Green=Tags(s)

MAKERCQKRSFQDTLEDIKNRMKEKRNKNLAGIGKRKSFIVAPGQVPTNTATLLRYYQDNNRLLVLALEN
EKSKVREAQDVILQLRKECYYLTCQLYALKEKLTSRQSEETTQNWKGRPSDVVSSIDNTTRDLSGKSLQQ
IAVEETDCPYQTTEPSPAVTPETQGCDFDSGKVESTDEVLPRTISIRRHLRKDFSNISHSTTLEDCKASP
RVAQSLEVKGSRCREVTVTLHRLENVCLWNKDQISLCSRLINPAKITETEVILSSKPEQIESKHKRARKR
RAEQRRTKQRCKSKSSLRSKGNKNKDKQGLPPTTLDGGIGSCDAYDFNLKGTVHPTPFRQKMNNGCNKET
DSSNSEVSDLECSTSEDESDDLYLPPSKRLRDYRESERAVTRPRSKRGLQYPDGKERKEVLPSTAPTGIP
PETQESPRCSLKDVTNILQCPRVKIRKPSLPPKRREDSPAVALTKRRCSTIKSYKEPTLASKLRRGDPFT
DLCFLNSPIFKQKRGMRCPKRRTKQTQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 59 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082508
Locus ID 72415
UniProt ID Q9CXH7
Refseq Size 3609
Cytogenetics 17 C
Refseq ORF 1551
Synonyms 3300001M08Rik; C81037; Sgo1; Sgol1
Summary Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Involved in centromeric enrichment of AUKRB in prometaphase.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...