Micu1 (NM_144822) Mouse Recombinant Protein
CAT#: TP507652
Purified recombinant protein of Mouse mitochondrial calcium uptake 1 (Micu1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207652 protein sequence
Red=Cloning site Green=Tags(s) MFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFLGASAVTASTGLLWKKAHAESPPCVNSKKPDT EDKERNKDSGEVSSREGRAADAAAEPYPEDKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVIN EPGETEVFMTPQDFVRSITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSD YIFLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSAL TTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQSKKLTAMQRQ LKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFA LFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 54.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_659071 |
Locus ID | 216001 |
UniProt ID | Q8VCX5 |
Refseq Size | 2358 |
Cytogenetics | 10 B4 |
Refseq ORF | 1434 |
Synonyms | C730016L05Rik; Calc; Cbara1 |
Summary | Key regulator of mitochondrial calcium uniporter (MCU) that senses calcium level via its EF-hand domains (PubMed:24560927). MICU1 and MICU2 form a disulfide-linked heterodimer that stimulates and inhibits MCU activity, depending on the concentration of calcium (PubMed:24560927). MICU1 acts both as an activator or inhibitor of mitochondrial calcium uptake (By similarity). Acts as a gatekeeper of MCU at low concentration of calcium, preventing channel opening (By similarity). Enhances MCU opening at high calcium concentration, allowing a rapid response of mitochondria to calcium signals generated in the cytoplasm (PubMed:24560927). Regulates glucose-dependent insulin secretion in pancreatic beta-cells by regulating mitochondrial calcium uptake (By similarity). Induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |