Ero1lb (NM_026184) Mouse Recombinant Protein
CAT#: TP507470
Purified recombinant protein of Mouse ERO1-like beta (S. cerevisiae) (Ero1lb), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR207470 protein sequence
Red=Cloning site Green=Tags(s) MSPGFRRAVTGQGAAAAVQLLVTLSFLSSLVKTQVTGVLDDCLCDIDSIDKFNTYKIFPKIKKLQERDYF RYYKVNLKRPCPFWAEDGHCSIKDCHVEPCPESKIPVGIKAGRSNKYSQAANSTKELDDCEQANKLGAIN STLSNESKEAFIDWARYDDSQDHFCELDDERSPAAQYVDLLLNPERYTGYKGSSAWRVWNSIYEENCFKP RSVYRPLNPLAPSRGEDDGESFYTWLEGLCLEKRVFYKLISGLHASINLHLCANYLLEETWGKPSWGPNI KEFRRRFDPVETKGEGPRRLKNLYFLYLIELRALSKVAPYFERSIVDLYTGNVEDDADTKTLLLSIFQDT KSFPMHFDEKSMFAGDKKGAKSLKEEFRLHFKNISRIMDCVGCDKCRLWGKLQTQGLGTALKILFSEKEI QNLPENSPSKGFQLTRQEIVALLNAFGRLSTSIRELQNFKALLQHRR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 53.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080460 |
Locus ID | 67475 |
UniProt ID | Q8R2E9 |
Refseq Size | 4255 |
Cytogenetics | 13 A1 |
Refseq ORF | 1404 |
Synonyms | 1300013B24Rik; 1700065B09Rik; AI447560; ero1-beta; Ero1b |
Summary | Oxidoreductase involved in disulfide bond formation in the endoplasmic reticulum. Efficiently reoxidizes P4HB/PDI, the enzyme catalyzing protein disulfide formation, in order to allow P4HB to sustain additional rounds of disulfide formation. Other protein disulfide isomerase family members can also be reoxidized, but at lower rates compared to P4HB, including PDIA2, PDIA3, PDIA4, PDIA6 and NXNDC12. Following P4HB reoxidation, passes its electrons to molecular oxygen via FAD, leading to the production of reactive oxygen species (ROS) in the cell (By similarity). Involved in oxidative proinsulin folding in pancreatic cells, hence required for glucose homeostasis in vivo.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |