Riox2 (NM_025910) Mouse Recombinant Protein

CAT#: TP507428

Purified recombinant protein of Mouse ribosomal oxygenase 2 (Riox2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (3)
RIOX2 Antibody - middle region
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207428 protein sequence
Red=Cloning site Green=Tags(s)

MPKKVQPTGDENEEESVPCKRVKEELPETLSVLNFDSPSSFFESLISPIKVETFFKEFWEQKPLLIQRDD
PVLAKYYQSLFSLSDLKRLCKKGVYYGRDVNVCRSISGKKKVLNKDGRAHFLQLRKDFDQKRATIQFHQP
QRYKDELWRIQEKLECYFGSLVGSNVYMTPAGSQGLPPHYDDVEVFILQLEGTKHWRLYSPTVPLAHEYS
VESEDRIGTPTHDFLLKPGDLLYFPRGTIHQAETPSGLAYSIHLTISTYQNNSWGDCLLDSISGFVFDIA
KEDVALRSGMPRRMLLNVETPADVTRKLSGFLRTLADQLEGREELLSSDMKKDFVKHRLPPFFEGNGTET
MDPGKQLPRLDNIIRLQFKDHIVLTVGPDKNPFDEAQQKVVYIYHSLKNVRQMHMIGEEEESEIFGLRFP
LSHVDALKQIWCGSPIRVKELKLDTDEEKENLALSLWSESLIQVL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080186
Locus ID 67014
UniProt ID Q8CD15
Refseq Size 2159
Cytogenetics 16 C1.3
Refseq ORF 1398
Synonyms 1810047J07Rik; 2410057H13Rik; 3830408E23Rik; AI449204
Summary Oxygenase that can act as both a histone lysine demethylase and a ribosomal histidine hydroxylase. Is involved in the demethylation of trimethylated 'Lys-9' on histone H3 (H3K9me3), leading to an increase in ribosomal RNA expression. Also catalyzes the hydroxylation of 60S ribosomal protein L27a on 'His-39' (By similarity). May play an important role in cell growth and survival. May be involved in ribosome biogenesis, most likely during the assembly process of pre-ribosomal particles.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...