Ctsc (NM_009982) Mouse Recombinant Protein

CAT#: TP507379

Purified recombinant protein of Mouse cathepsin C (Ctsc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207379 protein sequence
Red=Cloning site Green=Tags(s)

MGPWTHSLRAVLLLVLLGVCTVRSDTPANCTYPDLLGTWVFQVGPRSSRSDINCSVMEATEEKVVVHLKK
LDTAYDELGNSGHFTLIYNQGFEIVLNDYKWFAFFKYEVRGHTAISYCHETMTGWVHDVLGRNWACFVGK
KVESHIEKVNMNAAHLGGLQERYSERLYTHNHNFVKAINTVQKSWTATAYKEYEKMSLRDLIRRSGHSQR
IPRPKPAPMTDEIQQQILNLPESWDWRNVQGVNYVSPVRNQESCGSCYSFASMGMLEARIRILTNNSQTP
ILSPQEVVSCSPYAQGCDGGFPYLIAGKYAQDFGVVEESCFPYTAKDSPCKPRENCLRYYSSDYYYVGGF
YGGCNEALMKLELVKHGPMAVAFEVHDDFLHYHSGIYHHTGLSDPFNPFELTNHAVLLVGYGRDPVTGIE
YWIIKNSWGSNWGESGYFRIRRGTDECAIESIAVAAIPIPKL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 52.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_034112
Locus ID 13032
UniProt ID P97821
Refseq Size 2472
Cytogenetics 7 D3
Refseq ORF 1389
Synonyms AI047818; CatC; D; DP; DPP1; DPPI
Summary This gene encodes a member of the peptidase C1 (papain) family of cysteine proteases. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the dipeptidyl peptidase 1 light, heavy, and exclusion domain chains, which together comprise one subunit of the homotetrameric enzyme. This enzyme has amino dipeptidase activity and may play a role in the activation of granzymes during inflammation. Homozygous knockout mice for this gene exhibit impaired granzyme activation and enhanced survival in a sepsis model. [provided by RefSeq, Aug 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...