Cblc (NM_001161844) Mouse Recombinant Protein

CAT#: TP507210

Purified recombinant protein of Mouse Casitas B-lineage lymphoma c (Cblc), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207210 representing NM_001161844
Red=Cloning site Green=Tags(s)

MAAAAAPRGWQRGEPRALSRAVKLLQRLEEQCRDPRMVTGPPSLRDLLPRTAQLLGEVAKARREAREDPE
GPGGADDFLAIYLANLEVKGRQVAELLPPRGKKDVNQDVFREGSRFRRQLAKLALIFSHMHAELSALFPA
GKYCGHLYQLTKGSAHIFWRQNCGVRCVLPWAEFQSLLCACHPVEPGPTMQALRSTLDLTCNGHVSVFEF
DVFTRLFQPWPTLLRNWQLLAVNHPGYMAFLTYDEVQTRLQAYRDKPGSYIFRPSCTRLGQWAIGYVSSD
GSILQTIPLNKPLLQVLLKGQKDGIFLFPDGKKHNPDLTELCRVEPYQRIQVSEDSDSQTCPFCRCEIKG
REAVSICQAQERPTEVRTAADGSRDNCHQEAAEQKLGPVIPSAPSLLPEDQFPQGPQDKGWLTLAPLALP
RLRPPLPLPKMASVLWEVTSRPRAREEATESS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 51.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001155316
Locus ID 80794
UniProt ID G3X9U0
Refseq Size 1530
Cytogenetics 7 A3
Refseq ORF 1356
Synonyms 2310076I21Rik; 2310079L19Rik; Cbl3
Summary Acts as an E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Functionally coupled with the E2 ubiquitin-protein ligases UB2D1, UB2D2 and UB2D3. Regulator of EGFR mediated signal transduction; upon EGF activation, ubiquitinates EGFR. Isoform 1, but not isoform 2, inhibits EGF stimulated MAPK1 activation. Promotes ubiquitination of SRC phosphorylated at 'Tyr-424', has the highest ubiquitin ligase activity among CBL family proteins. In collaboration with CD2AP may act as regulatory checkpoint for Ret signaling by modulating the rate of RET degradation after ligand activation; CD2AP converts it from an inhibitor to a promoter of RET degradation; the function limits the potency of GDNF on neuronal survival.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...