Itfg2 (NM_133927) Mouse Recombinant Protein

CAT#: TP507058

Purified recombinant protein of Mouse integrin alpha FG-GAP repeat containing 2 (Itfg2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR207058 representing NM_133927
Red=Cloning site Green=Tags(s)

MRSVSYVQRVALDFSGSLFPHAICLGDVDNDALNELVVGDTSGKLSVYKNDDSRPWLTCMCQGMLTCVGV
GDVCNKGKNLVVAVSAEGWLHLFDLTPTKALDASGHHETLGEEQRPVFKQHIPANTKVMLISDIDGDGCY
ELVVGYTDRVVRAFRWEELAEGPEHLAGQLVSLKKWMLEGQVDSLSVTPGPLGVPELVVSQPGCAYAVLL
CTWNKDTGSPPASEEATGDSRETPAARDVVLHQTSGRIHNKNVSTHLIGNIRQGHNPEGGNAGLFALCTL
DGTLKLMQEADKLLWSVQVDHQLFALEKLDVTGNGLEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFC
AGQYACKEGRNSPCLVYVTFNQKIYVYWEVQLERMESTNLLKLLEAEPEYHRLLQELRVDPEDLPAVCTL
LHQTLYHPDQPLQCTPSSFQDPT

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 49 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598688
Locus ID 101142
UniProt ID Q91WI7
Refseq Size 2314
Cytogenetics 6 F3
Refseq ORF 1329
Synonyms 2700050P07Rik; AI646725
Summary As part of the KICSTOR complex functions in the amino acid-sensing branch of the TORC1 signaling pathway. Recruits, in an amino acid-independent manner, the GATOR1 complex to the lysosomal membranes and allows its interaction with GATOR2 and the RAG GTPases. Functions upstream of the RAG GTPases and is required to negatively regulate mTORC1 signaling in absence of amino acids. In absence of the KICSTOR complex mTORC1 is constitutively localized to the lysosome and activated. The KICSTOR complex is also probably involved in the regulation of mTORC1 by glucose.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...