Arl13b (NM_026577) Mouse Recombinant Protein

CAT#: TP506808

Purified recombinant protein of Mouse ADP-ribosylation factor-like 13B (Arl13b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206808 protein sequence
Red=Cloning site Green=Tags(s)

MFSLMANCCNLFKRWREPVRKVTLVMVGLDNAGKTATAKGIQGEHPEDVAPTVGFSKIDLRQGKFQVTIF
DLGGGKRIRGIWKNYYAESYGVIFVVDSSDEERMEETKETMSEVLRHPRISGKPILVLANKQDKEGALGE
ADVIECLSLEKLVNEHKCLCQIEPCSAVLGYGKKIDKSIKKGLYWLLHIIAKDFDALSERIQKDTTEQRA
LEEQEKRERAERVRKLREEREREQTELDGTSGLAEIDSGPVLANPFQPIAAVIIENEKKQEKEKKKQTVE
KDSDVGLLEHKVEPEQAAPQSEADCCLQNPDERVVDSYREALSQQLDSEDEQDQRGSESGENSKKKTKKL
RMKRSQRVEPVNTDESTPKSPTPPQPPPPVGWGTPKVTRLPKLEPLGETRHNDFYGKPLPPLAVRQRPNG
DAQDTIS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 48.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080853
Locus ID 68146
UniProt ID Q640N2, Q9CUD0
Refseq Size 3541
Cytogenetics 16 C1.3
Refseq ORF 1284
Synonyms A530097K21Rik; A930014M17Rik; Arl2l1; C530009C10Rik; hnn
Summary Cilium-specific protein required to control the microtubule-based, ciliary axoneme structure. May act by maintaining the association between IFT subcomplexes A and B. Binds GTP but is not able to hydrolyze it; the GTPase activity remains unclear. Required to pattern the neural tube. Involved in cerebral cortex development: required for the initial formation of a polarized radial glial scaffold, the first step in the construction of the cerebral cortex, by regulating ciliary signaling (PubMed:23817546). Regulates the migration and placement of postmitotic interneurons in the developing cerebral cortex (PubMed:23153492).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...