Entpd5 (NM_001026214) Mouse Recombinant Protein

CAT#: TP506800

Purified recombinant protein of Mouse ectonucleoside triphosphate diphosphohydrolase 5 (Entpd5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206800 protein sequence
Red=Cloning site Green=Tags(s)

MATSWGAVFMLIIACVGSTVFYREQQTWFEGVFLSSMCPINVSAGTFYGIMFDAGSTGTRIHVYTFVQKT
AGQLPFLEGEIFDSVKPGLSAFVDQPKQGAETVQELLEVAKDSIPRSHWERTPVVLKATAGLRLLPEQKA
QALLLEVEEIFKNSPFLVPDGSVSIMDGSYEGILAWVTVNFLTGQLHGRGQETVGTLDLGGASTQITFLP
QFEKTLEQTPRGYLTSFEMFNSTFKLYTHSYLGFGLKAARLATLGALEAKGTDGHTFRSACLPRWLEAEW
IFGGVKYQYGGNQEGEMGFEPCYAEVLRVVQGKLHQPEEVRGSAFYAFSYYYDRAADTHLIDYEKGGVLK
VEDFERKAREVCDNLGSFSSGSPFLCMDLTYITALLKDGFGFADGTLLQLTKKVNNIETGWALGATFHLL
QSLGITS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001021385
Locus ID 12499
UniProt ID Q9WUZ9
Refseq Size 4987
Cytogenetics 12 39.18 cM
Refseq ORF 1284
Synonyms AI196558; AI987697; Cd39l4; ER-UDPase; mNTPase; NTPDase-5; NTPDase5; Pcph
Summary Uridine diphosphatase (UDPase) that promotes protein N-glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. The nucleotide hydrolyzing preference is GDP > IDP > UDP, but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...