Acp2 (NM_007387) Mouse Recombinant Protein
CAT#: TP506733
Purified recombinant protein of Mouse acid phosphatase 2, lysosomal (Acp2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206733 protein sequence
Red=Cloning site Green=Tags(s) MAGRQTGWSQAALLQFLLGMCLTVMPPIQARSLRFVTLLYRHGDRSPVKTYPKDPYQEEKWPQGFGQLTK EGMLQHWELGQALRQRYHGFLNTSYHRQEVYVRSTDFDRTLMSAEANLAGLFPPNEVQHFNPNISWQPIP VHTVPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNRSIQNAQFLNMVANETGLTNVTLETIWNVYDTL FCEQTHGLLLPPWASPQTVQRLSQLKDFSFLFLFGIHEQVQKARLQGGVLLAQILKNLTLMATTSQFPKL LVYSAHDTTLVALQMALNVYNGKQAPYASCHIFELYQEDNGNFSVEMYFRNDSKKAPWPLILPGCPHRCP LQDFLRLTEPVIPKDWQKECQLANDTADTEVIVALAVCGSILFLLIVLLLTILFRMQAQPPGYHHVADRE DHA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 48.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031413 |
Locus ID | 11432 |
UniProt ID | P24638 |
Refseq Size | 4669 |
Cytogenetics | 2 50.54 cM |
Refseq ORF | 1272 |
Synonyms | Acp; Acp-2; LAP |
Summary | The protein encoded by this gene belongs to the histidine acid phosphatase family, which hydrolyze orthophosphoric monoesters to alcohol and phosphate. This protein is localized to the lysosomal membrane, and is chemically and genetically distinct from the red cell acid phosphatase. Mice lacking this gene showed multiple defects, including bone structure alterations, lysosomal storage defects, and an increased tendency towards seizures. An enzymatically-inactive allele of this gene showed severe growth retardation, hair-follicle abnormalities, and an ataxia-like phenotype. Two isoforms are predicted to be produced from the same mRNA by the use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2017] |
Documents
FAQs |
SDS |