Pdk3 (NM_145630) Mouse Recombinant Protein

CAT#: TP506565

Purified recombinant protein of Mouse pyruvate dehydrogenase kinase, isoenzyme 3 (Pdk3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206565 protein sequence
Red=Cloning site Green=Tags(s)

MRLFYRLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANTMREVNLLPDN
LLNRPSVGLVQSWYMQSFLELLEYENKSPEDPRVLDNFLNVLINIRNRHNDVVPTMAQGVIEYKEKFGFD
PFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAHPKHIGSIDPTCNVADVVKDAYETAKMLCEQ
YYLVAPELEVEEFNAKAPNKPIQVVYVPSHLFHMLFELFKNSMRATVELHEDKKEGYPAVKTLVTLGKED
LSIKISDLGGGVPLRKIDRLFNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGV
GTDAVIYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKSNRTF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_663605
Locus ID 236900
UniProt ID Q922H2, Q4FJR4
Refseq Size 2000
Cytogenetics X C3
Refseq ORF 1248
Synonyms 2610001M10Rik; AI035637
Summary Inhibits pyruvate dehydrogenase activity by phosphorylation of the E1 subunit PDHA1, and thereby regulates glucose metabolism and aerobic respiration. Can also phosphorylate PDHA2. Decreases glucose utilization and increases fat metabolism in response to prolonged fasting, and as adaptation to a high-fat diet. Plays a role in glucose homeostasis and in maintaining normal blood glucose levels in function of nutrient levels and under starvation. Plays a role in the generation of reactive oxygen species (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...