Mknk1 (NM_021461) Mouse Recombinant Protein

CAT#: TP506550

Purified recombinant protein of Mouse MAP kinase-interacting serine/threonine kinase 1 (Mknk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206550 protein sequence
Red=Cloning site Green=Tags(s)

MGSSEPLPIVDSDKRRKKKRKTRATDSLPGKFEDVYQLTSELLGEGAYAKVQGAVNLQSGKEYAVKIIEK
QAGHSRSRVFREVETLYQCQGNRNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKRKHFNEREASRVVR
DVATALDFLHTKGIAHRDLKPENILCESPEKVSPVKICDFDLGSGVKLNNSCTPITTPELTTPCGSAEYM
APEVVEVFRDEATFYDKRCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRMCQNKLFESIQEGKY
EFPDKDWAHISNEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPERGLPTPQVLQRNSSTMDLTLFAA
EAIALNRQLSQHEENELAEEQEALAEGLCSMKLSPPSKSRLARRRALAQAGRSRDANPCLTPAGL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_067436
Locus ID 17346
UniProt ID O08605
Refseq Size 2554
Cytogenetics 4 D1
Refseq ORF 1248
Synonyms 2410048M24Rik; Mnk; Mnk1
Summary This gene encodes a serine-threonine protein kinase that is activated by extracellular signal-regulated kinase or p38 mitogen-activated protein kinases, and it may function in cytokine and environmental stress responses. This kinase is required for phosphorylation of eukaryotic translation initiation factor 4E but it is not required for cell growth during development. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Oct 2013]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...