Klf15 (NM_023184) Mouse Recombinant Protein

CAT#: TP506548

Purified recombinant protein of Mouse Kruppel-like factor 15 (Klf15), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206548 protein sequence
Red=Cloning site Green=Tags(s)

MVDHLLPVDETFSSPKCSVGYLGDRLASRQPYHMLPSPISEDDSDVSSPCSCASPDSQAFCSCYSAGPGP
EAQGSILDFLLSRATLGSGGGSGGIGDSSGPVTWGSWRRASVPVKEEHFCFPEFLSGDTDDVSRPFQPTL
EEIEEFLEENMEAEVKEAPENGSRDLETCSQLSAGSHRSHLHPESAGRERCTPPPGGTSGGGAQSAGEGP
AHDGPVPVLLQIQPVAVKQEAGTGPASPGQAPESVKVAQLLVNIQGQTFALLPQVVPSSNLNLPSKFVRI
APVPIAAKPIGSGSLGPGPAGLLVGQKFPKNPAAELLKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPF
ACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRAVRAIN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 44.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_075673
Locus ID 66277
UniProt ID Q9EPW2
Refseq Size 2294
Cytogenetics 6 D1
Refseq ORF 1248
Synonyms 1810013I09Rik; AV048136; AW494632; CKLF; KKLF
Summary Transcriptional regulator that binds to the GA element of the CLCNKA promoter (By similarity). Binds to the KCNIP2 promoter and regulates KCNIP2 circadian expression in the heart. Is a repressor of CCN2 expression, involved in the control of cardiac fibrosis. Is also involved in the control of cardiac hypertrophy acting through the inhibition of MEF2A, GATA4 and MYOCD activity. Is a negative regulator of TP53 acetylation. Inhibits NF-kappa-B activation through repression of EP300-dependent RELA acetylation (By similarity). Involved in podocyte differentiation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...