Ddx17 (NM_199079) Mouse Recombinant Protein

CAT#: TP506397

Purified recombinant protein of Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (Ddx17), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Cited in 1 publication.

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206397 protein sequence
Red=Cloning site Green=Tags(s)

MRGGGFGDRDRDRDRGGFGARGGSGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEV
DELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGS
GKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIR
DLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATW
PKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMVSEKDHKLIQLMEEIMAEKENKTIIFVETKR
RCDDLTRRMRRYGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGLYR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_951061
Locus ID 67040
UniProt ID Q501J6
Refseq Size 2860
Cytogenetics 15 E1
Refseq ORF 1224
Synonyms 2610007K22Rik; A430025E01Rik; AI047725; C80929; Gm926; p7; p72
Summary This gene encodes the mouse homolog of human DEAD box polypeptide 17. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). RNA helicases of the DEAD-box family are involved in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Documents

Customer Reviews 
Loading...