Ddx17 (NM_199079) Mouse Recombinant Protein
CAT#: TP506397
Purified recombinant protein of Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 (Ddx17), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 1 publication. |
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206397 protein sequence
Red=Cloning site Green=Tags(s) MRGGGFGDRDRDRDRGGFGARGGSGLPPKKFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEV DELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGS GKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIR DLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATW PKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMVSEKDHKLIQLMEEIMAEKENKTIIFVETKR RCDDLTRRMRRYGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGLYR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 46.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_951061 |
Locus ID | 67040 |
UniProt ID | Q501J6 |
Refseq Size | 2860 |
Cytogenetics | 15 E1 |
Refseq ORF | 1224 |
Synonyms | 2610007K22Rik; A430025E01Rik; AI047725; C80929; Gm926; p7; p72 |
Summary | This gene encodes the mouse homolog of human DEAD box polypeptide 17. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). RNA helicases of the DEAD-box family are involved in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and splicesosome assembly. Alternative splicing of this gene results in several transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A network comprising short and long noncoding RNAs and RNA helicase controls mouse retina architecture
,null,
Nature Communications
,PubMed ID 26041499
[Ddx17]
|
Documents
FAQs |
SDS |