Olfml3 (NM_133859) Mouse Recombinant Protein

CAT#: TP506381

Purified recombinant protein of Mouse olfactomedin-like 3 (Olfml3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206381 protein sequence
Red=Cloning site Green=Tags(s)

MGPSAPLLLLFFLSWTGPLQGQQHHLVEYMERRLAALEERLAQCQDQSSRHAAELRDFKNKMLPLLEVAE
KERETLRTEADSISGRVDRLEREVDYLETQNPALPCVELDEKVTGGPGAKGKGRRNEKYDMVTDCSYTVA
QVRSMKILKRFGGSAGLWTKDPLGPAEKIYVLDGTQNDTAFVFPRLRDFTLAMAARKASRIRVPFPWVGT
GQLVYGGFLYYARRPPGGPGGGGELENTLQLIKFHLANRTVVDSSVFPAESLIPPYGLTADTYIDLAADE
EGLWAVYATRDDDRHLCLAKLDPQTLDTEQQWDTPCPRENAEAAFVICGTLYVVYNTRPASRARIQCSFD
ASGTLAPERAALSYFPRRYGAHASLRYNPRERQLYAWDDGYQIVYKLEMKKKEEEV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_598620
Locus ID 99543
UniProt ID Q8BK62
Refseq Size 1736
Cytogenetics 3 F2.2
Refseq ORF 1221
Synonyms 2810002E22Rik; AI115209; AW550633; HNOEL-iso; mONT3; ONT3
Summary Secreted scaffold protein that plays an essential role in dorsoventral patterning during early development. Stabilizes axial formation by restricting chordin (CHRD) activity on the dorsal side. Acts by facilitating the association between the tolloid proteases and their substrate chordin (CHRD), leading to enhance chordin (CHRD) degradation (By similarity). May have matrix-related function involved in placental and embryonic development, or play a similar role in other physiological processes (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...