Hmbox1 (BC051457) Mouse Recombinant Protein
CAT#: TP506358
Purified recombinant protein of Mouse homeobox containing 1 (cDNA clone MGC:56991 IMAGE:6398463), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR206358 protein sequence
Red=Cloning site Green=Tags(s) MLSSFPVVLLETMSHYTDEPRFTIEQIDLLQRLRRTGMTKHEILHALETLDRLDQEHSDKFGRRSSYGGS SYGNSTNNVPASSSTATASTQTQHSGMSPSPSNSYDTSPLPCTTNQNGRENNDRLSTSNGKMSPSRYHAN SMGQRSYSFEASEEDLDVDDKVEELMRRDSSVIKEEIKAFLANRRISQAVVAQVTGISQSRISHWLLQQG SDLSEQKKRAFYRWYQLEKTNPGATLSMRPAPIPIEDPEWRQTPPPVSATPGTFRLRRGSRFTWRKECLA VMESYFNENQYPDEAKREEIANACNAVIQKPGKKLSDLERVTSLKVYNWFANRRKEIKRRANIEAAILES HGIDVQSPGGHSNSDDVDGNDYSEQSSFAGALIQLERQKGPPGCQQLPVLSGLL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 45.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 219150 |
UniProt ID | Q8BJA3 |
Refseq Size | 3435 |
Cytogenetics | 14 D1 |
Refseq ORF | 1212 |
Synonyms | AI451877; AI604847; F830020C16Rik |
Summary | Binds directly to 5'-TTAGGG-3' repeats in telomeric DNA (By similarity). Associates with the telomerase complex at sites of active telomere processing and positively regulates telomere elongation (By similarity). Important for TERT binding to chromatin, indicating a role in recruitment of the telomerase complex to telomeres (PubMed:23685356). Also plays a role in the alternative lengthening of telomeres (ALT) pathway in telomerase-negative cells where it promotes formation and/or maintenance of ALT-associated promyelocytic leukemia bodies (APBs) (By similarity). Enhances formation of telomere C-circles in ALT cells, suggesting a possible role in telomere recombination (By similarity). Might also be involved in the DNA damage response at telomeres (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |