Wtip (NM_207212) Mouse Recombinant Protein

CAT#: TP506247

Purified recombinant protein of Mouse WT1-interacting protein (Wtip), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206247 representing NM_207212
Red=Cloning site Green=Tags(s)

MQRSRTAADDAALLLAGLGLRESEPTAGSPGRVRRGPRAVDEAAPASGRRGKGGCGGPEAAPDVPSRPER
GPRASLAGSDGGSARSSGISLGYDQRHGPGPGPPSGGSARSSVSSLGSRGSAGACADLLPPGVGPAPARS
PEPAQFPFPLPSLPLPPGREGGPSAAERRLEALTRELERALEARTARDYFGICIKCGLGIYGARQACQAM
GSLYHTDCFICDSCGRRLRGKAFYNVGEKVYCQEDFLYSGFQQTADKCSVCGHLIMEMILQALGKSYHPG
CFRCSVCNECLDGVPFTVDVDNNIYCVRDYHTVFAPKCASCARPILPAQGCETTIRVVSMDRDYHVECYH
CEDCGLQLSGEEGRRCYPLEGHLLCRRCHLRRLGQGPLPSPAVHVTEL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_997095
Locus ID 101543
UniProt ID Q7TQJ8
Refseq Size 1958
Cytogenetics 7 B1
Refseq ORF 1194
Summary Adapter or scaffold protein which participates in the assembly of numerous protein complexes and is involved in several cellular processes such as cell fate determination, cytoskeletal organization, repression of gene transcription, cell-cell adhesion, cell differentiation, proliferation and migration. Positively regulates microRNA (miRNA)-mediated gene silencing. Negatively regulates Hippo signaling pathway and antagonizes phosphorylation of YAP1. Acts as a transcriptional corepressor for SNAI1 and SNAI2/SLUG-dependent repression of E-cadherin transcription. Acts as a hypoxic regulator by bridging an association between the prolyl hydroxylases and VHL enabling efficient degradation of HIF1A. In podocytes, may play a role in the regulation of actin dynamics and/or foot process cytoarchitecture. In the course of podocyte injury, shuttles into the nucleus and acts as a transcription regulator that represses WT1-dependent transcription regulation, thereby translating changes in slit diaphragm structure into altered gene expression and a less differentiated phenotype. Involved in the organization of the basal body (By similarity). Involved in cilia growth and positioning (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...