Ugcg (NM_011673) Mouse Recombinant Protein

CAT#: TP506157

Purified recombinant protein of Mouse UDP-glucose ceramide glucosyltransferase (Ugcg), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206157 representing NM_011673
Red=Cloning site Green=Tags(s)

MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNL
ETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPAYEVAKYDLI
WICDSGIRVIPDTLTDMVNQMTEKVGLVHGLPYVADRQGFAATLEQVYFGTSHPRSYISANVTGFKCVTG
MSCLMRKDVLDQAGGLIAFAQYIAEDYFMAKAIADRGWRFSMSTQVAMQNSGSYSISQFQSRMIRWTKLR
INMLPATIICEPISECFVASLIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYA
VAWFIRESMTIYIFLSALWDPTISWRTGRYRLRCGGTAEEILDV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035803
Locus ID 22234
UniProt ID O88693
Refseq Size 3719
Cytogenetics 4 B3
Refseq ORF 1182
Synonyms AU043821; C80537; Epcs21; GlcT-1; Ugcgl
Summary Catalyzes at the cytosolic surface of the Golgi, the initial step of the glucosylceramide-based glycosphingolipid/GSL synthetic pathway, the transfer of glucose from UDP-glucose to ceramide to produce glucosylceramide/GlcCer (PubMed:10430909, PubMed:16109770, PubMed:28373486). Glucosylceramide is the core component of glycosphingolipids/GSLs, amphipathic molecules consisting of a ceramide lipid moiety embedded in the outer leaflet of the membrane, linked to one of hundreds of different externally oriented oligosaccharide structures (PubMed:10430909). Glycosphingolipids are essential components of membrane microdomains that mediate membrane trafficking and signal transduction (PubMed:10430909). They are implicated in many fundamental cellular processes, including growth, differentiation, migration, morphogenesis, cell-to-cell and cell-to-matrix interactions (PubMed:10430909). They are required for instance in the proper development and functioning of the nervous system (PubMed:16109770). As an example of their role in signal transduction, they regulate the leptin receptor/LEPR in the leptin-mediated signaling pathway (PubMed:23554574). They also play an important role in the establishment of the skin barrier regulating keratinocyte differentiation and the proper assembly of the cornified envelope (PubMed:17145749, PubMed:23748427). The biosynthesis of GSLs is also required for the proper intestinal endocytic uptake of nutritional lipids (PubMed:22851168).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...