Serpina10 (BC018416) Mouse Recombinant Protein

CAT#: TP506155

Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 (cDNA clone, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR206155 protein sequence
Red=Cloning site Green=Tags(s)

MRVASSLFLPVLLTEVWLVTSFNLSSHSPEASVHLESQDYENQTWEEYTRTDPREEEEEEEEKEEGKDEE
YWLRASQQLSNETSSFGFNLLRKISMRHDGNVIFSPFGLSVAMVNLMLGTKGETKVQIENGLNLQALSQA
GPLILPALFKKVKETFSSNRDLGLSQGSFAFIHKDFDIKETYFNLSKKYFDIEYVSINFQNSSQARGLIN
HCIVKETEGKIPKLFDEINPETKLILVDYVLFKGNATMLVVLMEKTGDYLALEDYLTVDLVETWLQNMKT
RKMEVFFPKFKLNQRYEMHELLKQMGIRRLFSTSADLSELSAMARNLQVSRVLQQSVLEVDERGTEAVSG
TLSEIIAYSMPPAIKVNRPFHFIIYEEMSRMLLFLGRVVNPTVL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 45.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 217847
UniProt ID Q8R121
Refseq Size 1450
Cytogenetics 12 E
Refseq ORF 1182
Synonyms MGC25863, ZPI, PZI
Summary The protein encoded by this gene is a member of the large serpin family of proteins, and is also known as serpin PZ-dependent protease inhibitor (ZPI or PZI). This protein is thought to play an important role in the regulation of coagulation. It directly inhibits factor XIa, and also inhibits factor Xa in the presence of calcium, phospholipids, and protein Z (PZ). Deficiencies in this gene lead to an increase in thrombosis. Alternative splicing results in multiple transcript variants that encode multiple protein isoforms. [provided by RefSeq, Aug 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...