Galt (NM_016658) Mouse Recombinant Protein

CAT#: TP505914

Purified recombinant protein of Mouse galactose-1-phosphate uridyl transferase (Galt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
现货

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205914 protein sequence
Red=Cloning site Green=Tags(s)

MAATFRASEHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGATRANGEVNPHY
DGTFLFDNDFPALQPDAPDPGTSDHPLFRAEAARGVCKVMCFHPWSDVTLPLMSVPEIRAVIDAWASVTE
ELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERSQQTYHSQHGKPLLLEYGHQELLRK
ERLVLTSEHWIVLVPFWAVWPFQTLLLPRRHVRRLPELNPAERDDLASIMKKLLTKYDNLFETSFPYSMG
WHGAPTGLKTGATCDHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYCLA
QKDKETAAIA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_057867
Locus ID 14430
UniProt ID Q03249
Refseq Size 2000
Cytogenetics 4 22.07 cM
Refseq ORF 1083
Synonyms AW553376
Summary The protein encoded by this gene is the second enzyme in the Leloir pathway, the metabolic pathway for D-galactose catabolism. It catalyzes the conversion of galactose-1-phosphate and uridine diphosphate-glucose to glucose-1-phosphate and uridine diphosphate galactose. Deficiency of this enzyme causes the genetic metabolic disorder galactosemia. Mice lacking this protein accumulate high levels of galactose and galactose-1 phosphate but are viable and fertile. This protein is negatively regulated through signaling by the polypeptide hormone prolactin, specifically via the short isoform of the prolactin receptor and the transcription factor Forkhead box O3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...