Galt (NM_016658) Mouse Recombinant Protein
CAT#: TP505914
Purified recombinant protein of Mouse galactose-1-phosphate uridyl transferase (Galt), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205914 protein sequence
Red=Cloning site Green=Tags(s) MAATFRASEHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGATRANGEVNPHY DGTFLFDNDFPALQPDAPDPGTSDHPLFRAEAARGVCKVMCFHPWSDVTLPLMSVPEIRAVIDAWASVTE ELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIAQREERSQQTYHSQHGKPLLLEYGHQELLRK ERLVLTSEHWIVLVPFWAVWPFQTLLLPRRHVRRLPELNPAERDDLASIMKKLLTKYDNLFETSFPYSMG WHGAPTGLKTGATCDHWQLHAHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYCLA QKDKETAAIA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 41.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057867 |
Locus ID | 14430 |
UniProt ID | Q03249 |
Refseq Size | 2000 |
Cytogenetics | 4 22.07 cM |
Refseq ORF | 1083 |
Synonyms | AW553376 |
Summary | The protein encoded by this gene is the second enzyme in the Leloir pathway, the metabolic pathway for D-galactose catabolism. It catalyzes the conversion of galactose-1-phosphate and uridine diphosphate-glucose to glucose-1-phosphate and uridine diphosphate galactose. Deficiency of this enzyme causes the genetic metabolic disorder galactosemia. Mice lacking this protein accumulate high levels of galactose and galactose-1 phosphate but are viable and fertile. This protein is negatively regulated through signaling by the polypeptide hormone prolactin, specifically via the short isoform of the prolactin receptor and the transcription factor Forkhead box O3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Documents
FAQs |
SDS |