Stn1 (NM_175360) Mouse Recombinant Protein
CAT#: TP505901
Purified recombinant protein of Mouse STN1, CST complex subunit (Stn1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
货期*
4周
规格
Product images
经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205901 protein sequence
Red=Cloning site Green=Tags(s) MECESSPREEEIPPLFWGLDPVFLAFAKLYIKDILEMKESQQVPGTYFYNGHPIRRVDIMGAVISVKERE TFYSYGVDDATGVINCVCWKKLSNAESSSDPAILSTARELSMTSQLKKLQETIEQKTRIGIGDIIRVRGS VRMFREEREICANIYYKVDDPVWNMQIARMLELPKLYQKVYDQPFRNPALQEEEALNNKDNLDLAGLTSL LSEKIKEFLQEKKMQSFYQQELETVESLQSLASRPVTHSTGSDQVELKDSGTSGVAQRVFKNALQLLQEK GLVFQRDSGSDKLYYVTTKDKDLQQKIYHIIKEDCQKPNHMEKGCHLLHILKCVHLNLRWDLSKAVLQRV LELLEDQSDIVSTADHYYAAF myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 42.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_780569 |
Locus ID | 108689 |
UniProt ID | Q8K2X3 |
Refseq Size | 1878 |
Cytogenetics | 19 C3 |
Refseq ORF | 1116 |
Synonyms | 0610009H20Rik; 2310057J23Rik; AAF-44; AAF44; AI413458; Obfc1; RPA-32 |
Summary | Component of the CST complex proposed to act as a specialized replication factor promoting DNA replication under conditions of replication stress or natural replication barriers such as the telomere duplex. The CST complex binds single-stranded DNA with high affinity in a sequence-independent manner, while isolated subunits bind DNA with low affinity by themselves. Initially the CST complex has been proposed to protect telomeres from DNA degradation (PubMed:19854130). However, the CST complex has been shown to be involved in several aspects of telomere replication. The CST complex inhibits telomerase and is involved in telomere length homeostasis; it is proposed to bind to newly telomerase-synthesized 3' overhangs and to terminate telomerase action implicating the association with the ACD:POT1 complex thus interfering with its telomerase stimulation activity. The CST complex is also proposed to be involved in fill-in synthesis of the telomeric C-strand probably implicating recruitment and activation of DNA polymerase alpha (PubMed:22748632). The CST complex facilitates recovery from many forms of exogenous DNA damage; seems to be involved in the re-initiation of DNA replication at repaired forks and/or dormant origins. Required for efficicient replication of the duplex region of the telomere. Promotes efficient replication of lagging-strand telomeres. Promotes general replication start following replication-fork stalling implicating new origin firing. May be in involved in C-strand fill-in during late S/G2 phase independent of its role in telomere duplex replication (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...