Parva (NM_020606) Mouse Recombinant Protein

CAT#: TP505736

Purified recombinant protein of Mouse parvin, alpha (Parva), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205736 protein sequence
Red=Cloning site Green=Tags(s)

MATSPQKSPLVPKSPTPKSPPSRKKDDSFLGKLGGTLARRKKAKEVSEFQEEGMNAINLPLSPISFELDP
EDTLLEENEVRTMVDPNSRNDPKLQELMKVLIDWINDVLVGERIIVKDLAEDLYDGQVLQKLFEKLESEK
LNVAEVTQSEIAQKQKLQTVLEKINETLKLPPRSIKWNVDSVHAKNLVAILHLLVALSQYFRAPIRLPDH
VSIQVVVVQKREGILQSRQIQEEITGNTEALSGRHERDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLN
LEVTELETQFADGVYLVLLMGLLEGYFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIV
NCDLKSTLRVLYNLFTKYRNVE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 42.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_065631
Locus ID 57342
UniProt ID Q9EPC1
Refseq Size 4450
Cytogenetics 7 F1
Refseq ORF 1119
Synonyms 2010012A22Rik; 5430400F08Rik; Actp; AI225929; AU042898; CH-ILKBP; Parvin
Summary Plays a role in the reorganization of the actin cytoskeleton, formation of lamellipodia and ciliogenesis. Plays a role in the establishement of cell polarity, cell adhesion, cell spreading, and directed cell migration. Plays a role in sarcomere organization and in smooth muscle cell contraction. Required for normal development of the embryonic cardiovascular system, and for normal septation of the heart outflow tract. Plays a role in sprouting angiogenesis and is required for normal adhesion of vascular smooth muscle cells to endothelial cells during blood vessel development.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...