Arpc1a (NM_019767) Mouse Recombinant Protein

CAT#: TP505701

Purified recombinant protein of Mouse actin related protein 2/3 complex, subunit 1A (Arpc1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205701 protein sequence
Red=Cloning site Green=Tags(s)

MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWTKAHELKEHNGHITGIDWAPKSDRIVTC
GADRNAYVWSQKDGIWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP
IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV
SFSASGNRLAWVSHDSTVSVADASKSVQVSTLRTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL
TFVSKLDVPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG
AMTIWDFKTLESSIQGLRIM

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_062741
Locus ID 56443
UniProt ID Q9R0Q6
Refseq Size 1588
Cytogenetics 5 G2
Refseq ORF 1113
Synonyms 41kDa; 0610010H08Rik; 1110030K07Rik; AA407347; Sid32; Sid329
Summary Probably functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks (By similarity). In addition to its role in the cytoplasmic cytoskeleton, the Arp2/3 complex also promotes actin polymerization in the nucleus, thereby regulating gene transcription and repair of damaged DNA (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...