Gga2 (BC057377) Mouse Recombinant Protein

CAT#: TP505395

Purified recombinant protein of Mouse golgi associated, gamma adaptin ear containing, ARF binding protein 2 (cDNA clone MGC:67474 IMAGE:5698559),, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205395 protein sequence
Red=Cloning site Green=Tags(s)

MLSMYRRPGHALPDQQALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVRLYKQVVEGR
VSAGNAVPAAVGAIPAPRAFPNPEPCGLNCPLIDLETPSLLHQDLAALGINDVPTRNQVVIPSCCNDKKQ
PGAITLMGGGIQSLSADRNLLDLFSPQPSPGLNYVPQKSIPKEVPPGTKASPGWSWEAGPLASSTASQNT
PLAHVFVPLESVKPSSLPPIVVYDRNGFRILLHFSQTGAPGHPDVKVLLLTMMSTATQPVWDVMFQVAVP
KSMRVKLQPASSSKLPAFSPLMPPAVISQTLLLDNPHKEPIRLRYKLTFNQGGQPFSEVGEVKDFPDLAV
LSTA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 38.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 74105
UniProt ID Q6P5E6
Refseq Size 2370
Cytogenetics 7 F2
Refseq ORF 1062
Synonyms 1200007E24Rik; mKIAA1080
Summary Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (DXXLL) motif. Mediates export of the GPCR receptor ADRA2B to the cell surface. Regulates retrograde transport of phosphorylated form of BACE1 from endosomes to the trans-Golgi network.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...