Atp6v0d2 (NM_175406) Mouse Recombinant Protein

CAT#: TP505301

Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V0 subunit D2 (Atp6v0d2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
ATP6V0D2 Antibody - middle region
    • 100 ul

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205301 representing NM_175406
Red=Cloning site Green=Tags(s)

MLETAELYFNVDHGYLEGLVRGCKASLLTQQDYVNLVQCETLEDLKIHLQTTDYGNFLANETNPLTVSKI
DTEMRKKLCREFDYFRNHSLEPLSTFLTYMTCSYMIDNIILLMNGALQKKSVKEVLAKCHPLGRFTEMEA
VNIAETPSDLFKAVLVETPLAPFFQDCMSENTLDELNIELLRNKLYKSYLEAFYKFCKDHGDVTADVMCP
ILEFEADRRALIITLNSFGTELSKEDRETLFPTCGRLYPEGLRLLAQAEDFEQMKRVADNYGVYKPLFDA
VGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEMRNIVWIAECISQRHRTKINSYIPIL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_780615
Locus ID 242341
UniProt ID Q80SY3
Refseq Size 2518
Cytogenetics 4 A3
Refseq ORF 1050
Synonyms 1620401A02Rik; AI324824; V-ATPase
Summary Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system (By similarity). May play a role in coupling of proton transport and ATP hydrolysis. Regulator of osteoclast fusion and bone formation.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...