Pomk (NM_029037) Mouse Recombinant Protein

CAT#: TP505284

Purified recombinant protein of Mouse protein-O-mannose kinase (Pomk), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205284 protein sequence
Red=Cloning site Green=Tags(s)

MGQQHGTRNGLTHRELPRGVGLLLAMALMNVALYLCLDQLFISPGRSTADSRRCPPGYFRMGRMRNCSRW
LSCEELRTEVRQLKRVGEGAVKRVFLSEWKEHKVALSRLTRLEMKEDFLHGLQMLKSLQSEHVVTLVGYC
EEDGTILTEYHPLGSLSNLEETLNLSKYQDVNTWQHRLQLAMEYVSIINYLHHSPLGTRVMCDSNDLPKT
LSQYLLTSNFSIVANDLDALPLVDHDSGILIKCGHRELHGDFVAPEQLWPYGEDTPFQDDLMPSYNEKVD
IWKIPDVSSFLLGHVEGSDMVRFHLFDIHKACKSQIPAKRPTAQNVLDAYQRVFHSLRDTVMSQTKEML

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 40 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_083313
Locus ID 74653
UniProt ID Q3TUA9
Refseq Size 3601
Cytogenetics 8 A2
Refseq ORF 1050
Synonyms 4930444A02Rik; Sgk196
Summary Protein O-mannose kinase that specifically mediates phosphorylation at the 6-position of an O-mannose of the trisaccharide (N-acetylgalactosamine (GalNAc)-beta-1,3-N-acetylglucosamine (GlcNAc)-beta-1,4-mannose) to generate phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-1,3-N-acetylglucosamine-beta-1,4-(phosphate-6-)mannose). Phosphorylated O-mannosyl trisaccharide is a carbohydrate structure present in alpha-dystroglycan (DAG1), which is required for binding laminin G-like domain-containing extracellular proteins with high affinity. Only shows kinase activity when the GalNAc-beta-3-GlcNAc-beta-terminus is linked to the 4-position of O-mannose, suggesting that this disaccharide serves as the substrate recognition motif (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...