Tcea3 (NM_011542) Mouse Recombinant Protein
CAT#: TP505243
Purified recombinant protein of Mouse transcription elongation factor A (SII), 3 (Tcea3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205243 protein sequence
Red=Cloning site Green=Tags(s) MGLEEELLRIAKKLEKMVSRKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCSDKEVVSLAKV LIKNWKRLLDSPRTTKGEREEREKAKKEKGLGCSDWKPEAGLSPPRKKGGGEPKTRRDSVDSRSSTTSSP KRPSLERSNSSKSKVETPTTPSSPSTPTFAPAVCLLAPCYLTGDSVRDKCVEMLSAALKAEDNFKDYGVN CDKLASEIEDHIYQELKSTDMKYRNRVRSRISNLKDPRNPGLRRNVLSGAISPELIAKMTAEEMASDELR ELRNAMTQEAIREHQMAKTGGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 38.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035672 |
Locus ID | 21401 |
UniProt ID | P23881 |
Refseq Size | 1247 |
Cytogenetics | 4 D3 |
Refseq ORF | 1044 |
Synonyms | S-II; SII-K1 |
Summary | Necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by S-II allows the resumption of elongation from the new 3'-terminus.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |