Slc25a33 (NM_027460) Mouse Recombinant Protein

CAT#: TP505182

Purified recombinant protein of Mouse solute carrier family 25, member 33 (Slc25a33), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205182 protein sequence
Red=Cloning site Green=Tags(s)

MATGTQQKENTLLHLFAGGCGGTVGAIFTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSV
TPGLLQVLKSILEKEGPKSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGVFVPNSNTVHILSAGSAAF
VTNTLMNPIWMVKTRMQLERKVRGCKQMNTLQCARRVYQTEGVRGFYRGLTASYAGISETIICFAIYESL
KKCLKDAPIVSSTDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHEVIRTRLREEGSKYRSFVQTARLVFR
EEGYLAFYRGLFAQLIRQIPNTAIVLSTYEFIVYLLGERA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_081736
Locus ID 70556
UniProt ID Q3TZX3
Refseq Size 1877
Cytogenetics 4 E2
Refseq ORF 963
Synonyms 5730438N18Rik; Pnc1
Summary Mitochondrial transporter that imports/exports pyrimidine nucleotides into and from mitochondria. Transports preferentially uracil, thymine, and cytosine (deoxy)nucleoside di- and triphosphates by an antiport mechanism. Also transports guanine but not adenine (deoxy)nucleotides. Is inhibited strongly by pyridoxal 5'-phosphate, 4,7-diphenyl-1,10-phenanthroline, tannic acid, and mercurials (mercury dichloride, mersalyl acid, p-hydroxymercuribenzoate). Participates in mitochondrial genome maintenance, regulation of mitochondrial membrane potential and mitochondrial respiration (By similarity). Upon INS or IGF1 stimulation regulates cell growth and proliferation by controlling mitochondrial DNA replication and transcription, the ratio of mitochondria-to nuclear-encoded components of the electron transport chain resulting in control of mitochondrial ROS production (PubMed:17596519). Participates in dendritic cell endocytosis and may associate with mitochondrial oxidative phosphorylation (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...