Thoc6 (NM_001008425) Mouse Recombinant Protein

CAT#: TP505121

Purified recombinant protein of Mouse THO complex 6 (Thoc6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205121 protein sequence
Red=Cloning site Green=Tags(s)

MEHAAPLAVPLGQAEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSAALSSEAKEESKKPVV
VFHAHDGPVYSMVSTDRHLLSAGDGEVKGWLWAEILKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS
LILAGGDCQLHSMDLETGAFTRALRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRIAKEVQTIEVYK
HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTVFPIRAPQKHVTFYQDLILSAGQGCCV
NHWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTASGNSCRVDVFTNLGYRAFSLSF

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001008425
Locus ID 386612
UniProt ID Q5U4D9
Refseq Size 1461
Cytogenetics 17 A3.3
Refseq ORF 1026
Synonyms F830014G06Rik; Wdr58
Summary Acts as component of the THO subcomplex of the TREX complex which is thought to couple mRNA transcription, processing and nuclear export, and which specifically associates with spliced mRNA and not with unspliced pre-mRNA. TREX is recruited to spliced mRNAs by a transcription-independent mechanism, binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export to the cytoplasm via the TAP/NFX1 pathway.Plays a role in apoptosis negative control involved in brain development (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...