Fnbp1 (NM_019406) Mouse Recombinant Protein
CAT#: TP505041
Purified recombinant protein of Mouse formin binding protein 1 (Fnbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR205041 protein sequence
Red=Cloning site Green=Tags(s) MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTAC KAFLSTLNEMNDYAGQHEVISENMTSQITVDLMRYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRR FERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRQQMAEDSKADYSLILQRFNQEQWEYYHTHIP NIFQKIQEMEERRIVRIGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVVEAYKSGFEPPG DIEFEDYTQPMKRTVSDNSLSSSKEGKPELRFGGKSRGKLWPFIKKNKVLAIWTLRGL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 40 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_062279 |
Locus ID | 14269 |
UniProt ID | Q80TY0 |
Refseq Size | 1983 |
Cytogenetics | 2 B |
Refseq ORF | 1017 |
Synonyms | 1110057E06Rik; 2210010H06Rik; FBP1; Fbp17 |
Summary | Required to coordinate membrane tubulation with reorganization of the actin cytoskeleton during the late stage of clathrin-mediated endocytosis. Binds to lipids such as phosphatidylinositol 4,5-bisphosphate and phosphatidylserine and promotes membrane invagination and the formation of tubules. Also enhances actin polymerization via the recruitment of WASL/N-WASP, which in turn activates the Arp2/3 complex. Actin polymerization may promote the fission of membrane tubules to form endocytic vesicles. May act as a link between RND2 signaling and regulation of the actin cytoskeleton. May be required for the lysosomal retention of FASLG/FASL (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |