St3gal1 (NM_009177) Mouse Recombinant Protein

CAT#: TP505017

Purified recombinant protein of Mouse ST3 beta-galactoside alpha-2,3-sialyltransferase 1 (St3gal1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR205017 protein sequence
Red=Cloning site Green=Tags(s)

MRRKTLKYLTFFLLFIFLTSFVLNYSNTGVPSAWFPKQMLLELSENFRRFIKSQPCTCRHCISQDKVSYW
FDQRFNKTMQPLLTVHNALMEEDTYRWWLRLQRERKPNNLSDTVKELFRLVPGNVDPMLNKRLVGCRRCA
VVGNSGNLKDSSYGPEIDSHDFVLRMNKAPTVGFEADVGSRTTHHLVYPESFRELGENVNMVLVPFKTTD
LQWVISATTTGTITHTYVPVPPKIKVKQEKILIYHPAFIKYVFDNWLQGHGRYPSTGILSIIFSIHICDE
VDLYGFGADSKGNWHHYWENNPSAGAFRKTGVHDGDFEYNITTTLAAINKIRIFKGR

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 39.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_033203
Locus ID 20442
UniProt ID P54751
Refseq Size 5784
Cytogenetics 15 D2
Refseq ORF 1014
Synonyms 5330418N22Rik; AI467004; Siat4; Siat4a; St3gal-1; ST3GalI
Summary Responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found on sugar chains O-linked to Thr or Ser and also as a terminal sequence on certain gangliosides. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...