Ubxn2b (NM_026534) Mouse Recombinant Protein

CAT#: TP504884

Purified recombinant protein of Mouse UBX domain protein 2B (Ubxn2b), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
UBXN2B Antibody - middle region
    • 50 ug

CNY 5,250.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204884 protein sequence
Red=Cloning site Green=Tags(s)

MAEGGRAEPEEQERGSSRPRPPSARDLQLALAELYEDEMKCKSSKPDRSTPATCRSPRTPPHRLYSGDHK
YDGLHIVQPPTGKIVNELFKEAREHGAVPLNEATRSSREDKTKSFTGGGYRLGNSFYKRSEYIYGENQLQ
DVQVLLKLWRNGFSLDDGELRPYSDPTNAQFLESVKRGETPLELQRLVHGAQVNLDMEDHQDQEYIKPRL
RFKAFSGEGQKLGSLTPEIVSTPSSPEEEDKSILNAAVLIDDSMPTTKIQIRLADGSRLVQRFNSTHRIL
DVRDFIVRSRPEFATTDFILVTSFPSKELTDETVTLQEADILNTVILQQLK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080810
Locus ID 68053
UniProt ID Q0KL01
Refseq Size 4735
Cytogenetics 4 A1
Refseq ORF 996
Synonyms 3110003A22Rik; 6430407D20Rik; AI451665; p37
Summary Adapter protein required for Golgi and endoplasmic reticulum biogenesis. Involved in Golgi and endoplasmic reticulum maintenance during interphase and in their reassembly at the end of mitosis. The complex formed with VCP has membrane fusion activity; membrane fusion activity requires USO1-GOLGA2 tethering and BET1L. VCPIP1 is also required, but not its deubiquitinating activity. Together with NSFL1C/p47, regulates the centrosomal levels of kinase AURKA/Aurora A during mitotic progression by promoting AURKA removal from centrosomes in prophase. Also, regulates spindle orientation during mitosis.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...