Ptgr1 (NM_025968) Mouse Recombinant Protein

CAT#: TP504840

Purified recombinant protein of Mouse prostaglandin reductase 1 (Ptgr1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Cited in 1 publication.

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR204840 protein sequence
Red=Cloning site Green=Tags(s)

MVQAKSWTLKKHFEGFPTDGNFELKTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDRMMGEQVAR
VVESKNSAFPKGTIVAALLGWTSHSISDGNGLTKLPVEWPDKLPLSLALGTVGMPGLTAYFGLLDICGVK
GGETVMVSAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDG
YDCYFDNVGGEFSNAVILQMKTFGRIAICGAISQYNRTGPCPQGPAPEVVIYQQLRMEGFIVNRWQGEVR
QKALTELMNWVSEGKVQYHEHVTEGFEKMPAAFMGMLKGENLGKTIVKA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 35.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_080244
Locus ID 67103
UniProt ID Q91YR9
Refseq Size 2104
Cytogenetics 4 B3
Refseq ORF 990
Synonyms 2510002C21Rik; Ltb4dh; Zadh3
Summary Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha. Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4 (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Documents

Customer Reviews 
Loading...